Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001758 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001758, RRID:AB_1080067
- Product name
- Anti-SOX9
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLP
HYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTG
LYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQ
HWEQPVYTQLTR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Contribution of Mature Hepatocytes to Biliary Regeneration in Rats with Acute and Chronic Biliary Injury.
Brg1 promotes both tumor-suppressive and oncogenic activities at distinct stages of pancreatic cancer formation.
Sox9 expression in canine epithelial skin tumors.
Prognostic Significance of β-Catenin, E-Cadherin, and SOX9 in Colorectal Cancer: Results from a Large Population-Representative Series.
Sox9 mediates Notch1-induced mesenchymal features in lung adenocarcinoma.
Cell differentiation versus cell death: extracellular glucose is a key determinant of cell fate following oxidative stress exposure.
Evaluation of protein biomarkers of prostate cancer aggressiveness.
Three-dimensional reconstructions of intrahepatic bile duct tubulogenesis in human liver.
Chen YH, Chen HL, Chien CS, Wu SH, Ho YT, Yu CH, Chang MH
PloS one 2015;10(8):e0134327
PloS one 2015;10(8):e0134327
Brg1 promotes both tumor-suppressive and oncogenic activities at distinct stages of pancreatic cancer formation.
Roy N, Malik S, Villanueva KE, Urano A, Lu X, Von Figura G, Seeley ES, Dawson DW, Collisson EA, Hebrok M
Genes & development 2015 Mar 15;29(6):658-71
Genes & development 2015 Mar 15;29(6):658-71
Sox9 expression in canine epithelial skin tumors.
Fantinato E, Milani L, Sironi G
European journal of histochemistry : EJH 2015 Jul 9;59(3):2514
European journal of histochemistry : EJH 2015 Jul 9;59(3):2514
Prognostic Significance of β-Catenin, E-Cadherin, and SOX9 in Colorectal Cancer: Results from a Large Population-Representative Series.
Bruun J, Kolberg M, Nesland JM, Svindland A, Nesbakken A, Lothe RA
Frontiers in oncology 2014;4:118
Frontiers in oncology 2014;4:118
Sox9 mediates Notch1-induced mesenchymal features in lung adenocarcinoma.
Capaccione KM, Hong X, Morgan KM, Liu W, Bishop JM, Liu L, Markert E, Deen M, Minerowicz C, Bertino JR, Allen T, Pine SR
Oncotarget 2014 Jun 15;5(11):3636-50
Oncotarget 2014 Jun 15;5(11):3636-50
Cell differentiation versus cell death: extracellular glucose is a key determinant of cell fate following oxidative stress exposure.
Poulsen RC, Knowles HJ, Carr AJ, Hulley PA
Cell death & disease 2014 Feb 20;5(2):e1074
Cell death & disease 2014 Feb 20;5(2):e1074
Evaluation of protein biomarkers of prostate cancer aggressiveness.
Rizzardi AE, Rosener NK, Koopmeiners JS, Isaksson Vogel R, Metzger GJ, Forster CL, Marston LO, Tiffany JR, McCarthy JB, Turley EA, Warlick CA, Henriksen JC, Schmechel SC
BMC cancer 2014 Apr 5;14:244
BMC cancer 2014 Apr 5;14:244
Three-dimensional reconstructions of intrahepatic bile duct tubulogenesis in human liver.
Vestentoft PS, Jelnes P, Hopkinson BM, Vainer B, Møllgård K, Quistorff B, Bisgaard HC
BMC developmental biology 2011 Sep 26;11:56
BMC developmental biology 2011 Sep 26;11:56
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SOX9 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and SOX9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424779).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA001758 antibody. Corresponding SOX9 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer shows moderate to strong nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate nuclear positivity in a subset of glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
- Sample type
- HUMAN