Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004092-M09 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004092-M09, RRID:AB_607056
- Product name
- SMAD7 monoclonal antibody (M09), clone 1G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMAD7.
- Antigen sequence
CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCN
PHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAV
PSSAETGGTNYLAPGGLSDSQLLLEPGDRSH- Isotype
- IgG
- Antibody clone number
- 1G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Aberrant expression in multiple components of the transforming growth factor-β1-induced Smad signaling pathway during 7,12-dimethylbenz[a]anthracene-induced hamster buccal-pouch squamous-cell carcinogenesis.
Chen YK, Yang SH, Huang AH, Hsue SS, Lin LM
Oral oncology 2011 Apr;47(4):262-7
Oral oncology 2011 Apr;47(4):262-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SMAD7 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SMAD7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol