Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00063876-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00063876-M01, RRID:AB_534983
- Product name
- PKNOX2 monoclonal antibody (M01), clone 4B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PKNOX2.
- Antigen sequence
PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRY
ITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQD
LLQNSPNSMSGVSNNPQGIVVPASALQQGN- Isotype
- IgG
- Antibody clone number
- 4B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PKNOX2 monoclonal antibody (M01), clone 4B6 Western Blot analysis of PKNOX2 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PKNOX2 expression in transfected 293T cell line by PKNOX2 monoclonal antibody (M01), clone 4B6.Lane 1: PKNOX2 transfected lysate(51.9 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PKNOX2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of PKNOX2 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PKNOX2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PKNOX2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol