Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008516-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008516-M02, RRID:AB_581854
- Product name
- ITGA8 monoclonal antibody (M02), clone 2G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITGA8.
- Antigen sequence
SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPN
PNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRK
RDVHVVEFHRQSPAKILNCTNIECLQISCA- Isotype
- IgG
- Antibody clone number
- 2G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Osteopontin is an activator of human adipose tissue macrophages and directly affects adipocyte function.
Zeyda M, Gollinger K, Todoric J, Kiefer FW, Keck M, Aszmann O, Prager G, Zlabinger GJ, Petzelbauer P, Stulnig TM
Endocrinology 2011 Jun;152(6):2219-27
Endocrinology 2011 Jun;152(6):2219-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ITGA8 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol