Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002110 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002110, RRID:AB_1855512
- Product name
- Anti-PODXL
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKC
EDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISL
ICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEIT
IHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Prognostic and predictive significance of podocalyxin-like protein expression in pancreatic and periampullary adenocarcinoma.
Podocalyxin Is a Marker of Poor Prognosis in Pancreatic Ductal Adenocarcinoma
Proteome-wide Epitope Mapping of Antibodies Using Ultra-dense Peptide Arrays
Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer.
Sialofucosylated podocalyxin is a functional E- and L-selectin ligand expressed by metastatic pancreatic cancer cells.
Methylation of an intronic region regulates miR-199a in testicular tumor malignancy
Overexpression of podocalyxin-like protein is an independent factor of poor prognosis in colorectal cancer
Heby M, Elebro J, Nodin B, Jirström K, Eberhard J
BMC clinical pathology 2015;15:10
BMC clinical pathology 2015;15:10
Podocalyxin Is a Marker of Poor Prognosis in Pancreatic Ductal Adenocarcinoma
Saukkonen K, Hagström J, Mustonen H, Juuti A, Nordling S, Fermér C, Nilsson O, Seppänen H, Haglund C, Real F
PLOS ONE 2015 June;10(6)
PLOS ONE 2015 June;10(6)
Proteome-wide Epitope Mapping of Antibodies Using Ultra-dense Peptide Arrays
Forsstrom B, Axnas B, Stengele K, Buhler J, Albert T, Richmond T, Hu F, Nilsson P, Hudson E, Rockberg J, Uhlen M
Molecular & Cellular Proteomics 2014 June;13(6):1585-1597
Molecular & Cellular Proteomics 2014 June;13(6):1585-1597
Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer.
Boman K, Larsson AH, Segersten U, Kuteeva E, Johannesson H, Nodin B, Eberhard J, Uhlén M, Malmström PU, Jirström K
British journal of cancer 2013 Jun 11;108(11):2321-8
British journal of cancer 2013 Jun 11;108(11):2321-8
Sialofucosylated podocalyxin is a functional E- and L-selectin ligand expressed by metastatic pancreatic cancer cells.
Dallas MR, Chen SH, Streppel MM, Sharma S, Maitra A, Konstantopoulos K
American journal of physiology. Cell physiology 2012 Sep 15;303(6):C616-24
American journal of physiology. Cell physiology 2012 Sep 15;303(6):C616-24
Methylation of an intronic region regulates miR-199a in testicular tumor malignancy
Cheung H, Davis A, Lee T, Pang A, Nagrani S, Rennert O, Chan W
Oncogene 2011 March;30(31):3404-3415
Oncogene 2011 March;30(31):3404-3415
Overexpression of podocalyxin-like protein is an independent factor of poor prognosis in colorectal cancer
Larsson A, Johansson M, Wangefjord S, Gaber A, Nodin B, Kucharzewska P, Welinder C, Belting M, Eberhard J, Johnsson A, Uhlén M, Jirström K
British Journal of Cancer 2011 August;105(5):666-672
British Journal of Cancer 2011 August;105(5):666-672
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli, plasma membrane, microtubule organizing center & vesicles.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and liver tissues using HPA002110 antibody. Corresponding PODXL RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong membranous positivity in endothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong positivity in cilia in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
- Sample type
- HUMAN