Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA134 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- Anti-human FABP4
- Antibody type
- Polyclonal
- Antigen
- Other
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAG
MAKPNMIISVNGDVITIKSESTFKNTEISFILGQE
FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTI
KRKREDDKLVVECVMKGVTSTRVYERALEHHHHHH- Vial size
- 200 µg
- Storage
- The lyophilized antibody is stable at room temperature for up to 1 month. The reconstituted antibody is stable for at least two weeks at 2-8 °C. Frozen aliquots are stable for at least 6 months when stored at -20 °C.
- Handling
- The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western analysis of recombinant human FABP4 [Cat# 400-018] using a rabbit polyclonal anti-human FABP4 antibody [Cat# 102-PA134]. [WB: AP-conjugated secondary antibody]
- Sample type
- Purified recombinant protein
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunofluorescence staining of human FABP4 in HDMECs with a polyclonal rabbit anti-human FABP4 antibody [Cat# 102-PA134]. The cells were permeabilized with 0.1% Triton X100. Conjugated secondary antibody: goat anti-rabbit ALEXA Flour 488 (1:600) [Dianova].
- Sample type
- Primary human dermal microvascular ECs
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Double IF staining of human FABP4 and CD31 in a coculture of HDLECs and C2C12 cells with a polyclonal rabbit anti-human FABP4 antibody [Cat# 102-PA134; Protein-A purified] and a monoclonal mouse anti-human CD31 antibody [Cat# 101-M92]. Conjugated secondary antibody: goat anti-rabbit ALEXA Flour 488 (1:600) [Dianova], goat anti-mouse PE (1:400) [Santa Cruz].
- Sample type
- HDLEC/C2C12 cells