Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000864-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000864-A01, RRID:AB_535324
- Product name
- RUNX3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant RUNX3.
- Antigen sequence
FPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQ
PQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRF
PDPRMHYPGAMSAAFP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Coexpression of Runx1 and Runx3 in mechanoreceptive dorsal root ganglion neurons.
Brn3a/Pou4f1 regulates dorsal root ganglion sensory neuron specification and axonal projection into the spinal cord.
Runx3 is required for the specification of TrkC-expressing mechanoreceptive trigeminal ganglion neurons.
Expression of Sema3D in subsets of neurons in the developing dorsal root ganglia of the rat.
Dynamic regulation of the expression of neurotrophin receptors by Runx3.
Yoshikawa M, Murakami Y, Senzaki K, Masuda T, Ozaki S, Ito Y, Shiga T
Developmental neurobiology 2013 Jun;73(6):469-79
Developmental neurobiology 2013 Jun;73(6):469-79
Brn3a/Pou4f1 regulates dorsal root ganglion sensory neuron specification and axonal projection into the spinal cord.
Zou M, Li S, Klein WH, Xiang M
Developmental biology 2012 Apr 15;364(2):114-27
Developmental biology 2012 Apr 15;364(2):114-27
Runx3 is required for the specification of TrkC-expressing mechanoreceptive trigeminal ganglion neurons.
Senzaki K, Ozaki S, Yoshikawa M, Ito Y, Shiga T
Molecular and cellular neurosciences 2010 Mar;43(3):296-307
Molecular and cellular neurosciences 2010 Mar;43(3):296-307
Expression of Sema3D in subsets of neurons in the developing dorsal root ganglia of the rat.
Takahashi K, Ishida M, Takahashi H
Neuroscience letters 2009 May 8;455(1):17-21
Neuroscience letters 2009 May 8;455(1):17-21
Dynamic regulation of the expression of neurotrophin receptors by Runx3.
Nakamura S, Senzaki K, Yoshikawa M, Nishimura M, Inoue K, Ito Y, Ozaki S, Shiga T
Development (Cambridge, England) 2008 May;135(9):1703-11
Development (Cambridge, England) 2008 May;135(9):1703-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RUNX3 polyclonal antibody (A01), Lot # 070226JCSa Western Blot analysis of RUNX3 expression in HepG2 ( Cat # L019V1 ).