Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183469 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Runt-Related Transcription Factor 3 (RUNX3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RUNX3 antibody: synthetic peptide directed towards the C terminal of mouse RUNX3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSM
AAAGG GERSPTRMLT- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Groucho/transducin-like Enhancer-of-split (TLE)-dependent and -independent transcriptional regulation by Runx3.
Yarmus M, Woolf E, Bernstein Y, Fainaru O, Negreanu V, Levanon D, Groner Y
Proceedings of the National Academy of Sciences of the United States of America 2006 May 9;103(19):7384-9
Proceedings of the National Academy of Sciences of the United States of America 2006 May 9;103(19):7384-9
No comments: Submit comment
No validations: Submit validation data