Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311168 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane Protein 126B (TMEM126B) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMEM126B antibody: synthetic peptide directed towards the middle region of human TMEM126B
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVP
LPPKG RVLIHWMTLC- Vial size
- 0.1 mg
Submitted references Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL
Proceedings of the National Academy of Sciences of the United States of America 2000 Aug 15;97(17):9543-8
Proceedings of the National Academy of Sciences of the United States of America 2000 Aug 15;97(17):9543-8
No comments: Submit comment
No validations: Submit validation data