Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501369 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRK
EFPKS EGQYSGFKSP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A comparative study of interleukin-1beta production and p2x7 expression after ATP stimulation by peripheral blood mononuclear cells isolated from rheumatoid arthritis patients and normal healthy controls.
Al-Shukaili A, Al-Kaabi J, Hassan B
Inflammation 2008 Apr;31(2):84-90
Inflammation 2008 Apr;31(2):84-90
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-P2RX7 Antibody Positive Control: Lane 1:541 μg mock transfected HEK-293Lane 2: 041 μg hP2X7 transfected HEK-293Lane 3: 041 μg mP2X7 transfected HEK-293Lane 4: 041 μg rP2X7 transfected HEK-293 Primary Antibody Dilution: 1:025Secondary Antibody: Anti-rabbit-HRPSecondry Antibody Dilution: 1:0000Submitted by: Ronald Sluyter, School of Biological Sciences, University of Wollongong