HPA008079

antibody from Atlas Antibodies

Targeting: RNF43 DKFZp781H0392, FLJ20315, URCC

Antibody data

Submit

Validation data

Product number: HPA008079 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA008079, RRID:AB_1856371
Product name: Anti-RNF43
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSY QEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVA RPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQ QRLAGAQHPYAQGWGLSHLQSTSQH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RNF43 protein structure - HPA008079 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and liver tissues using HPA008079 antibody. Corresponding RNF43 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN