Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051191-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051191-A01, RRID:AB_894114
- Product name
- HERC5 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HERC5.
- Antigen sequence
YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL
EEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWN
ERDPIRALTCFSVLFLPKYSTMETVEEALQEAINN
NRGFG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Interferon-induced HERC5 is evolving under positive selection and inhibits HIV-1 particle production by a novel mechanism targeting Rev/RRE-dependent RNA nuclear export.
Human HERC5 restricts an early stage of HIV-1 assembly by a mechanism correlating with the ISGylation of Gag.
Woods MW, Tong JG, Tom SK, Szabo PA, Cavanagh PC, Dikeakos JD, Haeryfar SM, Barr SD
Retrovirology 2014 Apr 3;11:27
Retrovirology 2014 Apr 3;11:27
Human HERC5 restricts an early stage of HIV-1 assembly by a mechanism correlating with the ISGylation of Gag.
Woods MW, Kelly JN, Hattlmann CJ, Tong JG, Xu LS, Coleman MD, Quest GR, Smiley JR, Barr SD
Retrovirology 2011 Nov 17;8:95
Retrovirology 2011 Nov 17;8:95
No comments: Submit comment
No validations: Submit validation data