H00000966-M02
antibody from Abnova Corporation
Targeting: CD59
16.3A5, EJ16, EJ30, EL32, G344, MIC11, MIN1, MIN2, MIN3, MSK21, p18-20
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000966-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000966-M02, RRID:AB_10793483
- Product name
- CD59 monoclonal antibody (M02), clone 3G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant CD59.
- Antigen sequence
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPT
ADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC
NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGT
SLSEKTVLLLVTPFLAAAWSLHP- Isotype
- IgG
- Antibody clone number
- 3G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CD59 expression in transfected 293T cell line by CD59 monoclonal antibody (M02), clone 3G6.Lane 1: CD59 transfected lysate (Predicted MW: 41.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CD59 monoclonal antibody (M02), clone 3G6. Western Blot analysis of CD59 expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CD59 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol