Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001312 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001312, RRID:AB_1080206
- Product name
- Anti-TAP2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC
YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDK
VMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAG
QKQRLAIARALVRDPRVLILDEATSALDVQCEQA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Molecular profiling and clinical outcome of high-grade serous ovarian cancer presenting with low- versus high-volume ascites.
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Feigenberg T, Clarke B, Virtanen C, Plotkin A, Letarte M, Rosen B, Bernardini MQ, Kollara A, Brown TJ, Murphy KJ
BioMed research international 2014;2014:367103
BioMed research international 2014;2014:367103
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in cells in seminiferus ducts.
- Sample type
- HUMAN