Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 20-783-73060 - Provider product page
- Provider
- GenWay
- Product name
- ZAP 70
- Antibody type
- Monoclonal
- Antigen
- A KLH conjugated peptide ""PQRRIDTLNSDGYTPEPARITSPDKPRPMP"" corresponding to amino acid residues 280-309 of human ZAP70.
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Vial size
- 0.025 mg
- Storage
- Store at +4Cor at -20Cif preferred.Storage in frost-free freezers is not recommended.This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
No comments: Submit comment
No validations: Submit validation data