ABIN2024350

antibody from antibodies-online

Targeting: ZAP70 SRK, STD, ZAP-70

ELISA

Antibody data

Submit

Validation data

Product number: ABIN2024350 - Provider product page
Provider: antibodies-online
Product name: anti-zeta-Chain (TCR) Associated Protein Kinase 70kDa (ZAP70) (AA 280-309) antibody (Biotin)
Antibody type: Monoclonal
Antigen: A KLH conjugated peptide \"PQRRIDTLNSDGYTPEPARITSPDKPRPMP\" corresponding to amino acid residues 280-309 of human ZAP70.
Reactivity: Human
Host: Mouse
Conjugate: Biotin
Epitope: AA 280-309
Isotype: IgG
Antibody clone number: SBZAP
Vial size: 25 μg
Concentration: 0.1 mg/mL
Storage: Keep as concentrated solution. Aliquot and store at -20°C or below.
Handling: Avoid multiple freeze-thaw cycles. Do NOT add Sodium Azide! Use of Sodium Azide will inhibit enzyme activity of horseradish peroxidase.

ZAP70 protein structure - ABIN2024350 shown in red.