Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN2494324 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-zeta-Chain (TCR) Associated Protein Kinase 70kDa (ZAP70) (AA 280-309) antibody (Biotin)
- Antibody type
- Monoclonal
- Antigen
- The immunogen for anti-ZAP70 antibody: a KLH conjugated peptide 'PQRRIDTLNSDGYTPEPARITSPDKPRPMP' corresponding to AA 280-309 of human ZAP70.
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Biotin
- Epitope
- AA 280-309
- Vial size
- 25 μg
- Storage
- Store at +4°C or at -20°C if preferred. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody
- Handling
- Avoid repeat freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting