Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN316506 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-zeta-Chain (TCR) Associated Protein Kinase 70kDa (ZAP70) (AA 280-309) antibody (Biotin)
- Antibody type
- Monoclonal
- Antigen
- A KLH conjugated peptide PQRRIDTLNSDGYTPEPARITSPDKPRPMP corresponding to aminoacid residues 280-309 of human ZAP70.
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Biotin
- Epitope
- AA 280-309
- Isotype
- IgG
- Antibody clone number
- SBZAP
- Vial size
- 25 μg
- Concentration
- 0.1 mg/mL
- Storage
- Store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch. Caution: (A full Health and Safety assessment is available upon request) This product containsSodium Azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled bytrained staff only.
No comments: Submit comment
No validations: Submit validation data