HPA023379

HEXDC antibody from Sigma-Aldrich
FLJ23825
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023379
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023379, RRID:AB_1850643
Product name
Anti-HEXDC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023379
Antibody type
Polyclonal
Antigen
Hexosaminidase domain-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGP
TDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAAC
LQLLLRGGFDEDVKAKVEN
Storage
-20C
Provider Type Product Number
- No reagents -