HPA023031

RNMTL1 antibody from Sigma-Aldrich
FLJ10581, HC90, MRM3, RMTL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023031
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023031, RRID:AB_1856387
Product name
Anti-RNMTL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023031
Antibody type
Polyclonal
Antigen
RNA methyltransferase-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPV
DKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKP
DHVKMTYPKTQLQHSLPLLLICDNLRDPGN
Storage
-20C
Provider Type Product Number
- No reagents -