Antibody data

Product number
H00023526-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023526-M06, RRID:AB_10963098
Product name
HMHA1 monoclonal antibody (M06), clone 4H7
Provider product page
Abnova Corporation - H00023526-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HMHA1.
Antigen sequence
HRSPLTAASPGELPTEGAGPDVVEDISHLLADVAR
FAEGLEKLKECVLHDDLLEARRPRAHECLGEALRV
MHQIISKYPLLNTVETLTAAGTLIAKVKAF
Isotype
IgG
Antibody clone number
4H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -