Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90971 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90971, RRID:AB_2665741
- Product name
- Anti-CARS
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
SQCNLYMAARKAVRKRPNQALLENIALYLTHMLKI
FGAVEEDSSLGFPVGGPGTSLSLEATVMPYLQVLS
EFREGVRKIAREQKVPEILQLSDALRDNILPELGV
RFEDHEGLPTVVKLVDRNTLLKEREEKRRVE- Epitope
- Binds to an epitope located within the peptide sequence EDSSLGFPVG as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL2304
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line U-251 MG
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line HeLa cytoplasmic fractionLane 3: Human cell line HeLa membrane fractionLane 4: Human cell line HeLa nuclear fractionLane 5: Human cell line HeLa chromatin fractionLane 6: Human cell line HeLa cytoskeletal fraction
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows cytoplasmic positivity in the trophoblast.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong cytoplasmic positivty in epidermis cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast cancer shows cytoplasmic immunoreactivity in tumor cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic immunoreactivity in glandular epithelium cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in renal tubules.