HPA002383

CARS antibody from Sigma-Aldrich
CARS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002383
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002383, RRID:AB_1078399
Product name
Anti-CARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002383
Antibody type
Polyclonal
Antigen
Cysteinyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQCNLYMAARKAVRKRPNQALLENIALYLTHMLKI
FGAVEEDSSLGFPVGGPGTSLSLEATVMPYLQVLS
EFREGVRKIAREQKVPEILQLSDALRDNILPELGV
RFEDHEGLPTVVKLVDRNTLLKEREEKRRVE
Storage
-20C
Provider Type Product Number
- No reagents -