HPA002384

CARS antibody from Sigma-Aldrich
CARS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002384
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002384, RRID:AB_1846033
Product name
Anti-CARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002384
Antibody type
Polyclonal
Antigen
Cysteinyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETT
DPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEV
NSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSK
LPKFWEGDFHRDMEALNVLPPDVL
Storage
-20C
Provider Type Product Number
- No reagents -