HPA002835

TROVE2 antibody from Sigma-Aldrich
Ro60, SSA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002835
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002835, RRID:AB_1857490
Product name
Anti-TROVE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002835
Antibody type
Polyclonal
Antigen
60 kDa SS-A/Ro ribonucleoprotein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTR
TEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQI
PAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAG
GVHPAIALREYRKKMDIPAKLIVCGMTSNGF
Storage
-20C
Provider Type Product Number
- No reagents -