HPA021316

WDR60 antibody from Atlas Antibodies
FAP163, FLJ10300
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021316
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021316, RRID:AB_2215577
Product name
Anti-WDR60
Provider product page
Atlas Antibodies - HPA021316
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASLDESGVLNVWVVVELPKADIAGSISDLGLMPGG
RVKLVHSALIQLGDSLSHKGNEFWGTTQTLNVKFL
PSDPNHFIIGTDMGLISHGTRQDLRVAPKLFKPQQ
HGIRPVKVN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -