HPA020607

WDR60 antibody from Sigma-Aldrich
FAP163, FLJ10300
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020607
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020607, RRID:AB_1858817
Product name
Anti-WDR60 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020607
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 60 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDA
VVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEP
SWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSL
HTSRVQRQMVVSVH
Storage
-20C
Provider Type Product Number
- No reagents -