HPA021316

WDR60 antibody from Sigma-Aldrich
FAP163, FLJ10300
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021316
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021316, RRID:AB_2215577
Product name
Anti-WDR60 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021316
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 60 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASLDESGVLNVWVVVELPKADIAGSISDLGLMPGG
RVKLVHSALIQLGDSLSHKGNEFWGTTQTLNVKFL
PSDPNHFIIGTDMGLISHGTRQDLRVAPKLFKPQQ
HGIRPVKVN
Storage
-20C
Provider Type Product Number
- No reagents -