HPA004125

MARS antibody from Atlas Antibodies
CMT2U, MetRS, SPG70
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA004125
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004125, RRID:AB_888610
Product name
Anti-MARS
Provider product page
Atlas Antibodies - HPA004125
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEE
ARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSS
QHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFIT
RSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYV
WFD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -