HPA004125

MARS antibody from Sigma-Aldrich
CMT2U, MetRS, SPG70
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004125
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004125, RRID:AB_1079312
Product name
Anti-MARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004125
Antibody type
Polyclonal
Antigen
Methionyl-tRNA synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEE
ARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSS
QHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFIT
RSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYV
WFD
Storage
-20C
Provider Type Product Number
- No reagents -