HPA013815

PCNXL2 antibody from Sigma-Aldrich
FLJ11383, KIAA0435
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013815
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013815, RRID:AB_2236561
Product name
Anti-PCNXL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013815
Antibody type
Polyclonal
Antigen
Pecanex-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SYRLHLMFDKGEVIQQKPSRKEEKPNKDKEA
Storage
-20C
Provider Type Product Number
- No reagents -