HPA013815

PCNXL2 antibody from Atlas Antibodies
FLJ11383, KIAA0435
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013815
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013815, RRID:AB_1669532
Product name
Anti-PCNXL2
Provider product page
Atlas Antibodies - HPA013815
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SYRLHLMFDKGEVIQQKPSRKEEKPNKDKEA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -