Antibody data

Product number
ABIN971075
Provider
antibodies-online
Product name
anti-Lymphoid-Restricted Membrane Protein (LRMP) (C-Term) antibody
Provider product page
antibodies-online - ABIN971075
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human
Host
Rabbit
Antigen sequence
SKQSEHRPSLPRFISTYSWADAEEEKCELKTKDDS
EPSGE ETVERTRKPS
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -