HPA002967

LRMP antibody from Sigma-Aldrich
JAW1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002967
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002967, RRID:AB_1079161
Product name
Anti-LRMP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002967
Antibody type
Polyclonal
Antigen
Lymphoid-restricted membrane protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSMEENGVERVCPESLLQSREYSSLPLPRHTSSTD
GTITSSDPGLEILNMASCDLDRNSLCKKEEDTRSA
SPTIEAQGTSPAHDNIAFQDSTSKDKTILNLEAKE
EPETIEEHKKEHASGDSVVSPLPVTTVKSVNVRQS
ENTSANEKEV
Storage
-20C
Provider Type Product Number
- No reagents -