Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501655 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Spi-B Transcription Factor (Spi-1/PU.1 Related) (SPIB) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPIB antibody: synthetic peptide directed towards the middle region of human SPIB
- Reactivity
- Human, Mouse, Rat, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
WGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRK
LTYQF DSALLPAVRR- Vial size
- 50 µg
Submitted references A functional MicroRNA-155 ortholog encoded by the oncogenic Marek's disease virus.
Delta-like1-induced Notch1 signaling regulates the human plasmacytoid dendritic cell versus T-cell lineage decision through control of GATA-3 and Spi-B.
Zhao Y, Yao Y, Xu H, Lambeth L, Smith LP, Kgosana L, Wang X, Nair V
Journal of virology 2009 Jan;83(1):489-92
Journal of virology 2009 Jan;83(1):489-92
Delta-like1-induced Notch1 signaling regulates the human plasmacytoid dendritic cell versus T-cell lineage decision through control of GATA-3 and Spi-B.
Dontje W, Schotte R, Cupedo T, Nagasawa M, Scheeren F, Gimeno R, Spits H, Blom B
Blood 2006 Mar 15;107(6):2446-52
Blood 2006 Mar 15;107(6):2446-52
No comments: Submit comment
No validations: Submit validation data