HPA018523

CTD-2545M3.6 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018523
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018523, RRID:AB_1857443
Product name
Anti-SPIB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018523
Antibody type
Polyclonal
Antigen
Transcription factor Spi-B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVP
ATPYEAFDPAAAAFSHPQAAQLCYEPPTYSPAGNL
ELAPSLEAPGPGLPAYPTENFASQTLVPPAYAPYP
SPVLSEEEDLPLDSPALEVSDSESDEALVA
Storage
-20C
Provider Type Product Number
- No reagents -