HPA019071

TWISTNB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019071
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019071, RRID:AB_1858465
Product name
Anti-TWISTNB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019071
Antibody type
Polyclonal
Antigen
DNA-directed RNA polymerase I subunit RPA43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DADDTPMEESALQNTNNANGIWEEEPKKKKKKKKH
QEVQDQDPVFQGSDSSGYQSDHKKKKKKRKHSEEA
EFTPPLKCSP
Storage
-20C
Provider Type Product Number
- No reagents -