HPA002844

FBXO18 antibody from Sigma-Aldrich
FBH1, Fbx18, FLJ14590
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002844
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002844, RRID:AB_1078829
Product name
Anti-FBXO18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002844
Antibody type
Polyclonal
Antigen
F-box only protein 18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQMTHDGYLKLWQLSKPSLASFDAIFVDEAQDCTP
AIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFT
VPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRK
KTLVGGNHQSGIRGDAK
Storage
-20C
Provider Type Product Number
- No reagents -