HPA024103

CCDC129 antibody from Sigma-Aldrich
FLJ38344
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024103
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024103, RRID:AB_1846132
Product name
Anti-CCDC129 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024103
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 129 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFSRDMSEEEREEAEQLQTLREALRQQVAELEFQL
GDRAQQIREGILLQLEVLTAEPPEHYSNLHQYNWI
EESNGQTSCSKIHPGMAPRTVFPPDDGQEAPCSGG
TQLAAFTPPTLENSTRMSPSSSAWAKLGPTPLSNC
PVGEKDAD
Storage
-20C
Provider Type Product Number
- No reagents -