HPA011790

WBP5 antibody from Sigma-Aldrich
DKFZp313K1940, TCEAL9, WEX6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011790
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011790, RRID:AB_2214932
Product name
Anti-WBP5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011790
Antibody type
Polyclonal
Antigen
WW domain-binding protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAK
GTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEI
DEIRRVRNKLIVMRWKVNRN
Storage
-20C
Provider Type Product Number
- No reagents -