HPA020615

ZCCHC6 antibody from Sigma-Aldrich
FLJ13409, KIAA1711, PAPD6, TUT7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020615
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020615, RRID:AB_1858983
Product name
Anti-ZCCHC6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020615
Antibody type
Polyclonal
Antigen
Zinc finger CCHC domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VARTLNSQPVFEYILHCLRTTYKYFALPHKITKSS
LLKPLNAITCISEHSKEVINHHPDVQTKDDKLKNS
VLAQGPGATSSAANTCKVQPLTLKETAESFGSPPK
EEMGNEHISVHPENSDCIQ
Storage
-20C
Provider Type Product Number
- No reagents -