HPA004335

ACPP antibody from Sigma-Aldrich
ACP-3, ACP3, PAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004335
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004335, RRID:AB_1079684
Product name
Anti-ACPP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004335
Antibody type
Polyclonal
Antigen
Prostatic acid phosphatase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKD
FIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNF
TLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKS
RLQGGVLVNEILNHMKRAT
Storage
-20C
Provider Type Product Number
- No reagents -