HPA024823

WDYHV1 antibody from Sigma-Aldrich
C8orf32, FLJ10204
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024823
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024823, RRID:AB_1845773
Product name
Anti-WDYHV1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024823
Antibody type
Polyclonal
Antigen
WDYHV motif-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSK
MNLNDFISMDPKVGWGAVYTLSEFTHRFGSK
Storage
-20C
Provider Type Product Number
- No reagents -