H00004241-M04A

MFI2 antibody from Abnova Corporation
CD228, FLJ38863, MAP97, MGC4856, MTf, MTF1
No application information provided.

Antibody data

Product number
H00004241-M04A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004241-M04A, RRID:AB_1577230
Product name
MFI2 monoclonal antibody (M04A), clone 1F7
Provider product page
Abnova Corporation - H00004241-M04A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MFI2.
Antigen sequence
MEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCV
RGTSADHCVQLIAAQEADAITLDGGAIYEAGKEHG
LKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLK
GVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDV
LKAVSDHFGGSCVPGAGETSYSESLCRLCRGDSPG
EGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHS
TVLENTDESPSRRQTWTRSEEEEGECPAHEEARRT
MRSSAGQAWKWAPVHRPQDESDKGEFGKRAKSRDM
LG
Isotype
IgM
Antibody clone number
1F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -