H00004241-B01P

MFI2 antibody from Abnova Corporation
CD228, FLJ38863, MAP97, MGC4856, MTf, MTF1

Antibody data

Product number
H00004241-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004241-B01P, RRID:AB_1577231
Product name
MFI2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00004241-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MFI2 protein.
Antigen sequence
MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHK
CGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQ
EADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGT
SYYAVAVVRRSSHVTIDTLKGVKSCHTGINRTVGW
NVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPG
AGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDY
SGAFRCLAEGAGDVAFVKHSTVLENTDESPSRRQT
WTRSEEEEGECPAHEEARRTMRSSAGQAWKWAPVH
RPQDESDKGEFGKRAKSRDMLG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -