ABIN786134

MFI2 antibody from antibodies-online
CD228, FLJ38863, MAP97, MGC4856, MTf, MTF1

Antibody data

Product number
ABIN786134
Provider
antibodies-online
Product name
anti-Antigen P97 (Melanoma Associated) Identified By Monoclonal Antibodies 133.2 and 96.5 (MFI2) (C-Term) antibody
Provider product page
antibodies-online - ABIN786134
Antibody type
Polyclonal
Antigen
The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2
Reactivity
Human
Host
Rabbit
Antigen sequence
CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQER
YYGYR GAFRCLVENA
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -