HPA004880

MFI2 antibody from Sigma-Aldrich
CD228, FLJ38863, MAP97, MGC4856, MTf, MTF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004880
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004880, RRID:AB_1853844
Product name
Anti-MFI2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004880
Antibody type
Polyclonal
Antigen
Melanotransferrin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMV
RPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSS
NYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVA
ALEGMSSQQC
Storage
-20C
Provider Type Product Number
- No reagents -