HPA024406

C16orf58 antibody from Sigma-Aldrich
FLJ13868
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024406
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024406, RRID:AB_1845580
Product name
Anti-C16orf58 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024406
Antibody type
Polyclonal
Antigen
UPF0420 protein C16orf58 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RALVMETLNEGRLRLVLKHYLQRGEVLDPTAANRM
EPLWTGFWPAPSLSLGVPLHRLVSSVFELQQLVEG
HQESYLLCWDQSQNQVQVVLNQKAGPKTILRA
Storage
-20C
Provider Type Product Number
- No reagents -