SAB2100255

C16orf58 antibody from Sigma-Aldrich
FLJ13868
No application information provided.

Antibody data

Product number
SAB2100255
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100255, RRID:AB_10602831
Product name
Anti-C16ORF58 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100255
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_073581.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLQAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSL
SGSLATQAVLLGIGV
Storage
-20C
Provider Type Product Number
- No reagents -