HPA021021

MURC antibody from Sigma-Aldrich
cavin-4, CAVIN4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021021
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021021, RRID:AB_1853082
Product name
Anti-MURC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021021
Antibody type
Polyclonal
Antigen
PTRF/SDPR family protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNK
FRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDI
FDPPVDLSSDEEYYVE
Storage
-20C
Provider Type Product Number
- No reagents -